Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OST4 (Oligosaccharyltransferase complex subunit 4, non-catalytic) Full Length (CAT#: MPC2251K) Made to Order

This product is a 4.1 kDa Human OST4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OST4
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 4.1 kDa
  • TMD
  • 1
  • Sequence
  • MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • OST4
  • Full Name
  • Oligosaccharyltransferase complex subunit 4, non-catalytic
  • Alternative Names
  • OST4; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4; oligosaccharyltransferase 4 homolog; Oligosaccharyltransferase complex subunit 4, non-catalytic

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us