Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OTOR (Otoraplin) expressed in E. coli for Antibody Discovery (CAT#: MP0020Q)

This product is a 14.3 kDa Human OTOR membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OTOR
  • Protein Length
  • Partial
  • Protein Class
  • Secreted Protein, Transmembrane
  • Molecular Weight
  • 14.3 kDa
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSHMLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purification
  • Conventional chromatography
  • Purity
  • >90% by SDS - PAGE
  • Buffer
  • Liquid, In Phosphate buffered saline (pH7.4) containing 30% glycerol, 1mM DTT

Target

  • Target Protein
  • OTOR
  • Full Name
  • Otoraplin
  • Introduction
  • This gene encodes a member of the melanoma-inhibiting activity gene family. The encoded protein is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness.
  • Alternative Names
  • FDP; MIAL1; otoraplin; fibrocyte-derived protein; melanoma inhibitory activity-like protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us