Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OXA1L (OXA1L mitochondrial inner membrane protein) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2089K)

This product is a Human OXA1L membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OXA1L
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 5
  • Sequence
  • MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • OXA1L
  • Full Name
  • OXA1L mitochondrial inner membrane protein
  • Introduction
  • This gene encodes an evolutionarily conserved protein that is localized to the inner mitochondrial membrane. The encoded protein is essential for the translocation of the N-terminal tail of subunit 2 of cytochrome c oxidase, and is involved in the assembly of the cytochrome c oxidase and ATPase complexes of the mitochondrial respiratory chain.
  • Alternative Names
  • OXA1L; OXA1; mitochondrial inner membrane protein OXA1L; OXA1-like protein; epididymis secretory sperm binding protein; oxidase (cytochrome c) assembly 1-like; OXA1L mitochondrial inner membrane protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us