Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human P2RY12 (Purinergic receptor P2Y12) expressed in E.coli for Antibody Discovery (CAT#: MP1365J)

This product is a 39.4 kDa Human P2RY12 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • P2RY12
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.4 kDa
  • TMD
  • 7
  • Sequence
  • MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-10xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • P2RY12
  • Full Name
  • Purinergic receptor P2Y12
  • Introduction
  • The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene.
  • Alternative Names
  • ADP glucose receptor; ADP-glucose receptor; ADPG R; ADPG-R; ADPGR; BDPLT8; G protein coupled receptor SP1999; Gi coupled ADP receptor HORK 3; Gi coupled ADP receptor HORK3; HORK 3; HORK3; P2RY 12; P2RY12; P2T(AC); P2Y 12; P2Y purinoceptor 12; P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2Y12; P2Y12 platelet ADP receptor; P2Y12_HUMAN; Platelet ADP receptor; Purinergic receptor P2RY12; Purinergic receptor P2Y G protein coupled 12; Purinergic receptor P2Y12; Putative G protein coupled receptor; SP 1999; SP1999

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us