Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PDCD1LG2 (Programmed cell death 1 ligand 2) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (21-118aa) (CAT#: MPX4677K)

This product is a 15.1 kDa Human PDCD1LG2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PDCD1LG2
  • Protein Length
  • Partial (21-118aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 15.1 kDa
  • TMD
  • 1
  • Sequence
  • FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • PDCD1LG2
  • Full Name
  • Programmed cell death 1 ligand 2
  • Alternative Names
  • B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2; B7 dendritic cell molecule; B7-DC; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us