Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PEDS1-UBE2V1 (PEDS1-UBE2V1 readthrough) (CAT#: MP0052J)

This product is a 42 kDa Human PEDS1-UBE2V1 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PEDS1-UBE2V1
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 42 kDa
  • Sequence
  • MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW
    EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC
    LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP
    RKHHRIHHVSPHETYFCITTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPR
    TIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRL
    MMSKENMKLPQPPEGQCYSN

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • PEDS1-UBE2V1
  • Full Name
  • PEDS1-UBE2V1 readthrough
  • Introduction
  • The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined.
  • Alternative Names
  • CROC-1B; CROC1B; KUA-UEV; TMEM189-UBE2V1; transmembrane protein 189-ubiquitin-conjugating enzyme E2 variant 1 read-through

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us