Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PERP (P53 apoptosis effector related to PMP22) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0923K)

This product is a Human PERP membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PERP
  • Protein Length
  • Full Length
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 41.4kDa
  • TMD
  • 4
  • Sequence
  • MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PERP
  • Full Name
  • P53 apoptosis effector related to PMP22
  • Alternative Names
  • PERP; THW; KCP1; EKVP7; OLMS2; PIGPC1; KRTCAP1; dJ496H19.1; 1110017A08Rik; KCP-1; PERP, TP53 apoptosis effector; keratinocyte-associated protein 1; keratinocytes associated protein 1; p53-induced protein PIGPC1; transmembrane protein THW; P53 apoptosis effector related to PMP22

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us