Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PGAP3 (Post-GPI attachment to proteins phospholipase 3) Full Length (CAT#: MPC2489K) Made to Order

This product is a made-to-order Human PGAP3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PGAP3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 7
  • Sequence
  • MAGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFR
    SRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFL
    FFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCVAFAWVSLNAW
    FWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR
    ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRL
    PHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFS
    FLEDDSLYLLKESEDKFKLD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PGAP3
  • Full Name
  • Post-GPI attachment to proteins phospholipase 3
  • Introduction
  • This gene encodes a glycosylphosphatidylinositol (GPI)-specific phospholipase that primarily localizes to the Golgi apparatus. This ubiquitously expressed gene is predicted to encode a seven-transmembrane protein that removes unsaturated fatty acids from the sn-2 position of GPI. The remodeling of the constituent fatty acids on GPI is thought to be important for the proper association between GPI-anchored proteins and lipid rafts. The tethering of proteins to plasma membranes via posttranslational GPI-anchoring is thought to play a role in protein sorting and trafficking. Mutations in this gene cause an autosomal recessive form of neurologic hyperphosphatasia with cognitive disability (HPMRS4). Alternative splicing results in multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • PGAP3; CAB2; PERLD1; PP1498; hCOS16; AGLA546; post-GPI attachment to proteins factor 3; COS16 homolog; gene coamplified with ERBB2 protein; per1-like domain containing 1; post-GPI attachment to proteins 3; Post-GPI attachment to proteins phospholipase 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us