Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VMA21 (Vacuolar ATPase assembly factor VMA21) Full Length (CAT#: MPC4755K) Made to Order

This product is a made-to-order Human VMA21 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VMA21
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
    YIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQ
    D

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • VMA21
  • Full Name
  • Vacuolar ATPase assembly factor VMA21
  • Introduction
  • This gene encodes a chaperone for assembly of lysosomal vacuolar ATPase.
  • Alternative Names
  • VMA21; MEAX; XMEA; vacuolar ATPase assembly integral membrane protein VMA21; VMA21 vacuolar H+-ATPase homolog; VMA21, vacuolar ATPase assembly factor; myopathy with excessive autophagy protein; Vacuolar ATPase assembly factor VMA21

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us