Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PIGP (Phosphatidylinositol glycan anchor biosynthesis class P) Full Length (CAT#: MPC4531K) Made to Order

This product is a made-to-order Human PIGP membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PIGP
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFG
    FILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGI
    NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA
    AKELYTKN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PIGP
  • Full Name
  • Phosphatidylinositol glycan anchor biosynthesis class P
  • Introduction
  • This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Alternative Names
  • PIGP; DCRC; DSRC; DEE55; DSCR5; PIG-P; DCRC-S; EIEE55; phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region gene 5; Down syndrome critical region protein 5; Down syndrome critical region protein C; phosphatidylinositol glycan, class P; phosphatidylinositol-glycan biosynthesis class P protein; phosphatidylinositol-n-acetylglucosaminyltranferase subunit; Phosphatidylinositol glycan anchor biosynthesis class P

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us