Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PILRB (Paired immunoglobin like type 2 receptor beta) Expressed in HEK293 for Antibody Discovery, Partial (20-189aa) (CAT#: MPX0499K)

This product is a 45.7 kDa Human PILRB membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PILRB
  • Protein Length
  • Partial (20-189aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 45.7 kDa
  • TMD
  • 1
  • Sequence
  • QPGGSTGSGPSYLYGVTQPKHLSASMGGSVE
    IPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLN
    WTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTIT
    QAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • PILRB
  • Full Name
  • Paired immunoglobin like type 2 receptor beta
  • Introduction
  • The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved in the regulation of many aspects of the immune system. The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This gene encodes the activating member of the receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs. This gene is thought to have arisen from a duplication of the inhibitory PILRA gene and evolved to acquire its activating function.
  • Alternative Names
  • PILRB; FDFACT1; FDFACT2; paired immunoglobulin-like type 2 receptor beta; activating receptor PILR-beta; activating receptor PILRbeta; cell surface receptor FDFACT; cell surface receptor FDFACT1; cell surface receptor FDFACT2; paired immunoglobin-like receptor beta; paired immunoglobulin-like receptor beta; Paired immunoglobin like type 2 receptor beta

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us