Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PLAAT3 (Phospholipase A and acyltransferase 3) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3712K)

This product is a Human PLAAT3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLAAT3
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PLAAT3
  • Full Name
  • Phospholipase A and acyltransferase 3
  • Alternative Names
  • PLAAT3; AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1; Ca-independent phospholipase A1/2; H-rev 107 protein homolog; HRAS-like suppressor 1; HRAS-like suppressor 3; adipose-specific PLA2; adipose-specific phospholipase A2; group XVI phospholipase A1/A2; group XVI phospholipase A2; phospholipase A/acyltransferase-3; phospholipase A2 group XVI; renal carcinoma antigen NY-REN-65; Phospholipase A and acyltransferase 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us