Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PLN (Phospholamban) Full Length (CAT#: MPC2030K) Made to Order

This product is a 6.1 kDa Human PLN membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLN
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 6.1 kDa
  • TMD
  • 1
  • Sequence
  • MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVM
    LL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PLN
  • Full Name
  • Phospholamban
  • Introduction
  • The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure, and also familial hypertrophic cardiomyopathy.
  • Alternative Names
  • PLN; PLB; CMD1P; CMH18; cardiac phospholamban; Phospholamban

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us