Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PLPP2 (Phospholipid phosphatase 2) Full Length (CAT#: MPC2997K) Made to Order

This product is a made-to-order Human PLPP2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLPP2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 6
  • Sequence
  • MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPD
    TITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLG
    TFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVC
    RGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQ
    FFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKAR
    PPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PLPP2
  • Full Name
  • Phospholipid phosphatase 2
  • Introduction
  • The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
  • Alternative Names
  • PLPP2; LPP2; PAP-2c; PAP2-g; PPAP2C; PAP2-gamma; PAP2c; lipid phosphate phosphohydrolase 2; phosphatidate phosphohydrolase type 2c; phosphatidic acid phosphatase 2c; phosphatidic acid phosphatase type 2C; phosphatidic acid phosphohydrolase type 2c; type-2 phosphatidic acid phosphatase-gamma; Phospholipid phosphatase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us