Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PRRG1 (Proline rich and Gla domain 1) Full Length (CAT#: MPC1963K) Made to Order

This product is a 24.9 kDa Human PRRG1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PRRG1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 24.9 kDa
  • TMD
  • 1
  • Sequence
  • MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREA
    FENNEKTKEFWSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFL
    IWRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLG
    YVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV
    NSNSASAIPMVPVVTTIK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PRRG1
  • Full Name
  • Proline rich and Gla domain 1
  • Introduction
  • This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • PRRG1; PRGP1; transmembrane gamma-carboxyglutamic acid protein 1; proline rich Gla (G-carboxyglutamic acid) 1; proline-rich Gla (G-carboxyglutamic acid) polypeptide 1; Proline rich and Gla domain 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us