Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PRSS8 (Serine protease 8) Full Length (CAT#: MPC1016K) Made to Order

This product is a 36.4 kDa Human PRSS8 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PRSS8
  • Protein Length
  • Full length
  • Protein Class
  • Protease
  • Molecular Weight
  • 36.4 kDa
  • TMD
  • 1
  • Sequence
  • MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSS
    AVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKL
    GAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYI
    RPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET
    CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLW
    YLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQ
    PDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PRSS8
  • Full Name
  • Serine protease 8
  • Introduction
  • This gene encodes a member of the peptidase S1 or chymotrypsin family of serine proteases. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate via a disulfide bond to form the heterodimeric enzyme. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. This protease exhibits trypsin-like substrate specificity, cleaving protein substrates at the carboxyl terminus of lysine or arginine residues. The encoded protease partially mediates proteolytic activation of the epithelial sodium channel, a regulator of sodium balance, and may also play a role in epithelial barrier formation.
  • Alternative Names
  • PRSS8; CAP1; PROSTASIN; prostasin; channel-activating protease 1; channel-activating serine protease 1; protease, serine 8; Serine protease 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us