Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PTGES (Prostaglandin E synthase) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2109K)

This product is a Human PTGES membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTGES
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 4
  • Sequence
  • MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PTGES
  • Full Name
  • Prostaglandin E synthase
  • Introduction
  • The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.
  • Alternative Names
  • PTGES; PGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1; MGST1-like 1; glutathione S-transferase 1-like 1; glutathione peroxidase PTGES; glutathione transferase PTGES; microsomal glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; tumor protein p53 inducible protein 12; Prostaglandin E synthase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us