Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PTGES2 (Prostaglandin E synthase 2) Expressed in E.coli for Antibody Discovery, Partial (88-377aa) (CAT#: MPX0814K)

This product is a 34 kDa Human PTGES2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTGES2
  • Protein Length
  • Partial (88-377aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 34 kDa
  • TMD
  • 1
  • Sequence
  • ERSAAQLSLSSRL
    QLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPI
    LVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGK
    EVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNV
    YRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
    DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAF
    DDLMQHTHIQPWYLRVERAITEASPAH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl, DTT and Glycerol.

Target

  • Target Protein
  • PTGES2
  • Full Name
  • Prostaglandin E synthase 2
  • Introduction
  • The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene.
  • Alternative Names
  • PTGES2; GBF1; GBF-1; PGES2; C9orf15; mPGES-2; GATE-binding factor 1; gamma-interferon-activated transcriptional element-binding factor 1; mPGE synthase-2; membrane-associated prostaglandin E synthase 2; microsomal prostaglandin E synthase-2; prostaglandin-H(2) E-isomerase; Prostaglandin E synthase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us