Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PTH1R (Parathyroid hormone 1 receptor) Expressed in CHO for Antibody Discovery, Partial (23-189aa) (CAT#: MPX0047K)

This product is a 20.0 kDa Human PTH1R membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTH1R
  • Protein Length
  • Partial (23-189aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 20.0 kDa
  • TMD
  • 7
  • Sequence
  • YALVDADDVMTKEEQIFLLHRAQAQCEK
    RLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTG
    SRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDR
    NGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • PTH1R
  • Full Name
  • Parathyroid hormone 1 receptor
  • Introduction
  • The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Two transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • PFE; EKNS; PTHR; PTHR1; parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHr receptor; PTH/PTHrP type I receptor; PTH1 receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related protein receptor; seven transmembrane helix receptor; PTH1R; Parathyroid hormone 1 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us