Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PTH2R (Parathyroid hormone 2 receptor) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (27-145aa) (CAT#: MPX4483K)

This product is a 29.6kDa Human PTH2R membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTH2R
  • Protein Length
  • Partial (27-145aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 29.6kDa
  • TMD
  • 7
  • Sequence
  • DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • PTH2R
  • Full Name
  • Parathyroid hormone 2 receptor
  • Introduction
  • The protein encoded by this gene is a member of the G-protein coupled receptor 2 family. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • PTHR2; parathyroid hormone 2 receptor; PTH2 receptor; parathyroid hormone receptor 2; PTH2R; Parathyroid hormone 2 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us