Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADGRG1 (Adhesion G protein-coupled receptor G1) Expressed in CHO for Antibody Discovery, Partial (26-342aa) (CAT#: MPX0021K)

This product is a 36.8 kDa Human ADGRG1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADGRG1
  • Protein Length
  • Partial (26-342aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 36.8 kDa
  • TMD
  • 7
  • Sequence
  • RGHREDFRFCSQRNQTHRSSLHYKP
    TPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGR
    LHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNIS
    LPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRP
    SAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLH
    IHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ
    DKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNV

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ADGRG1
  • Full Name
  • Adhesion G protein-coupled receptor G1
  • Introduction
  • This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • BFPP; BPPR; GPR56; TM7LN4; TM7XN1; 7-transmembrane protein with no EGF-like N-terminal domains-1; G protein-coupled receptor 56; testicular tissue protein Li 77; ADGRG1; Adhesion G protein-coupled receptor G1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us