Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RAET1E (Retinoic acid early transcript 1E) Full Length (CAT#: MPC2582K) Made to Order

This product is a made-to-order Human RAET1E membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RAET1E
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • TMD
  • 1
  • Sequence
  • MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWC
    EAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRD
    LRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLF
    DAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHW
    EAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQN
    GEWQAGLWPLRTS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • RAET1E
  • Full Name
  • Retinoic acid early transcript 1E
  • Introduction
  • This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. This protein functions as a ligand for NKG2D receptor, which is expressed on the surface of several types of immune cells, and is involved in innate and adaptive immune responses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • RAET1E; RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7; NKG2D ligand 4; RAE-1-like transcript 4; UL16-binding protein 4; lymphocyte effector toxicity activation ligand; Retinoic acid early transcript 1E

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us