Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human REEP6 (Receptor accessory protein 6) Full Length (CAT#: MPC4301K) Made to Order

This product is a made-to-order Human REEP6 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • REEP6
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLF
    GYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEF
    FSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGA
    VDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADL
    KPSQTPQPKDK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • REEP6
  • Full Name
  • Receptor accessory protein 6
  • Introduction
  • The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77.
  • Alternative Names
  • REEP6; RP77; DP1L1; TB2L1; Yip2f; REEP6.1; REEP6.2; C19orf32; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; Receptor accessory protein 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us