Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RGR (Retinal G protein coupled receptor) Full Length (CAT#: MPC1089K) Made to Order

This product is a 31.8 kDa Human RGR membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RGR
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 31.8 kDa
  • TMD
  • 7
  • Sequence
  • MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTP
    CHLLVLSLALADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTAL
    ASICSSAAIAWGRYHHYCTRSQLAWNSAVSLVLFVWLSSAFWAALPLLGW
    GHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSYSLME
    QKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVIADVTSISPKLQMVP
    ALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • RGR
  • Full Name
  • Retinal G protein coupled receptor
  • Introduction
  • This gene encodes a putative retinal G-protein coupled receptor. The gene is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. The protein acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The protein is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • RGR; RP44; RPE-retinal G protein-coupled receptor; RGR-opsin; Retinal G protein coupled receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us