Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RNF5 (Ring finger protein 5) Full Length (CAT#: MPC1946K) Made to Order

This product is a 19.8 kDa Human RNF5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RNF5
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 19.8 kDa
  • TMD
  • 2
  • Sequence
  • MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPC
    LHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQG
    QRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGV
    DLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • RNF5
  • Full Name
  • Ring finger protein 5
  • Introduction
  • The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
  • Alternative Names
  • RNF5; RMA1; RING5; E3 ubiquitin-protein ligase RNF5; RING-type E3 ubiquitin transferase RNF5; protein G16; ram1 homolog; ring finger protein 5, E3 ubiquitin protein ligase; Ring finger protein 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us