Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ROBO3 (Roundabout guidance receptor 3) Expressed in NS0 for Antibody Discovery, Partial (40-545aa) (CAT#: MPX0242K)

This product is a 82 kDa Human ROBO3 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ROBO3
  • Protein Length
  • Partial (40-545aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 82 kDa
  • TMD
  • 1
  • Sequence
  • LNHTLLPPGDP
    SLNGSRVGPEDAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKN
    GARVATVREDPRAHRLLLPSGALFFPRIVHGRRARPDEGVYTCVARNYLG
    AAASRNASLEVAVLRDDFRQSPGNVVVAVGEPAVLECVPPRGHPEPSVSW
    RKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASNMAGERESAAA
    EVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGELPT
    GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLV
    TQPQDQMAAPGESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGR
    FSVSPRGQLNITAVQRGDAGYYVCQAVSVAGSILAKALLEIKGASLDGLP
    PVILQGPANQTLVLGSSVWLPCRVTGNPQPSVRWKKDGQWLQGDDLQFKT
    MANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMREDWGVS

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ROBO3
  • Full Name
  • Roundabout guidance receptor 3
  • Introduction
  • This gene is a member of the Roundabout (ROBO) gene family that controls neurite outgrowth, growth cone guidance, and axon fasciculation. ROBO proteins are a subfamily of the immunoglobulin transmembrane receptor superfamily. SLIT proteins 1-3, a family of secreted chemorepellants, are ligands for ROBO proteins and SLIT/ROBO interactions regulate myogenesis, leukocyte migration, kidney morphogenesis, angiogenesis, and vasculogenesis in addition to neurogenesis. This gene, ROBO3, has a putative extracellular domain with five immunoglobulin (Ig)-like loops and three fibronectin (Fn) type III motifs, a transmembrane segment, and a cytoplasmic tail with three conserved signaling motifs: CC0, CC2, and CC3 (CC for conserved cytoplasmic). Unlike other ROBO family members, ROBO3 lacks motif CC1. The ROBO3 gene regulates axonal navigation at the ventral midline of the neural tube. In mouse, loss of Robo3 results in a complete failure of commissural axons to cross the midline throughout the spinal cord and the hindbrain. Mutations ROBO3 result in horizontal gaze palsy with progressive scoliosis (HGPPS); an autosomal recessive disorder characterized by congenital absence of horizontal gaze, progressive scoliosis, and failure of the corticospinal and somatosensory axon tracts to cross the midline in the medulla.
  • Alternative Names
  • ROBO3; HGPS; RIG1; HGPPS; RBIG1; HGPPS1; roundabout homolog 3; retinoblastoma inhibiting gene 1; roundabout, axon guidance receptor, homolog 3; roundabout-like protein 3; Roundabout guidance receptor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us