Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ROMO1 (Reactive oxygen species modulator 1) Full Length (CAT#: MPC4390K) Made to Order

This product is a made-to-order Human ROMO1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ROMO1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGR
    ELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • ROMO1
  • Full Name
  • Reactive oxygen species modulator 1
  • Introduction
  • The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.
  • Alternative Names
  • ROMO1; MTGM; MTGMP; C20orf52; bA353C18.2; PCM19; ROS modulator 1; epididymis tissue protein Li 175; glyrichin; mitochondrial targeting GXXXG protein; mitochondrial targeting GxxxG motif protein; protein MGR2 homolog; Reactive oxygen species modulator 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us