Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RXFP4 (Relaxin family peptide/INSL5 receptor 4) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3491K)

This product is a Human RXFP4 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RXFP4
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • RXFP4
  • Full Name
  • Relaxin family peptide/INSL5 receptor 4
  • Introduction
  • GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
  • Alternative Names
  • RXFP4; GPR100; RLN3R2; RXFPR4; GPCR142; relaxin-3 receptor 2; G protein-coupled receptor 100; G-protein coupled receptor GPCR142; RLN3 receptor 2; insulin-like peptide INSL5 receptor; relaxin family peptide receptor 4; relaxin/insulin like family peptide receptor 4; Relaxin family peptide/INSL5 receptor 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us