Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SC5D (Sterol-C5-desaturase) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2402K)

This product is a Human SC5D membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SC5D
  • Protein Length
  • Full Length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 4
  • Sequence
  • MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SC5D
  • Full Name
  • Sterol-C5-desaturase
  • Introduction
  • This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
  • Alternative Names
  • SC5D; ERG3; S5DES; SC5DL; lathosterol oxidase; 3beta-hydroxysteroid-delta5-desaturase; C-5 sterol desaturase; delta(7)-sterol 5(6)-desaturase; delta(7)-sterol 5-desaturase; delta(7)-sterol C5(6)-desaturase; fungal ERG3, delta-5-desaturase-like; lathosterol 5-desaturase; lathosterol dehydrogenase; sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like; Sterol-C5-desaturase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us