Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SCAMP3 (Secretory carrier membrane protein 3) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (2-170aa) (CAT#: MPX4431K)

This product is a 45.9kDa Human SCAMP3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SCAMP3
  • Protein Length
  • Partial (2-170aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 45.9kDa
  • TMD
  • 4
  • Sequence
  • AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SCAMP3
  • Full Name
  • Secretory carrier membrane protein 3
  • Introduction
  • This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • SCAMP3; C1orf3; secretory carrier-associated membrane protein 3; propin 1; Secretory carrier membrane protein 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us