Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SCO2 (Synthesis of cytochrome C oxidase 2) Full Length (CAT#: MPC2098K) Made to Order

This product is a 29.8 kDa Human SCO2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SCO2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 29.8 kDa
  • TMD
  • 1
  • Sequence
  • MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQG
    QPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVG
    QGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQ
    LEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQ
    ASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQI
    SDSVRRHMAAFRSVLS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SCO2
  • Full Name
  • Synthesis of cytochrome C oxidase 2
  • Introduction
  • Cytochrome c oxidase (COX) catalyzes the transfer of electrons from cytochrome c to molecular oxygen, which helps to maintain the proton gradient across the inner mitochondrial membrane that is necessary for aerobic ATP production. Human COX is a multimeric protein complex that requires several assembly factors; this gene encodes one of the COX assembly factors. The encoded protein is a metallochaperone that is involved in the biogenesis of cytochrome c oxidase subunit II. Mutations in this gene are associated with fatal infantile encephalocardiomyopathy and myopia 6.
  • Alternative Names
  • SCO2; TP; MYP6; TYMP; ECGF1; SCO1L; MC4DN2; CEMCOX1; PD-ECGF; TdRPase; Gliostatin; protein SCO2 homolog, mitochondrial; Platelet-derived endothelial cell growth factor; SCO cytochrome c oxidase assembly protein 2; SCO cytochrome oxidase deficient homolog 2; SCO2, cytochrome c oxidase assembly protein; Thymidine phosphorylase; Synthesis of cytochrome C oxidase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us