Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SDC2 (Syndecan 2) Full Length (CAT#: MPC2429K) Made to Order

This product is a made-to-order Human SDC2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SDC2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDD
    YASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQ
    TKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVI
    AGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFY
    A

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • SDC2
  • Full Name
  • Syndecan 2
  • Introduction
  • The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types.
  • Alternative Names
  • SDC2; HSPG; CD362; HSPG1; SYND2; syndecan-2; cell surface-associated heparan sulfate proteoglycan 1; fibroglycan; heparan sulfate proteoglycan 1, cell surface-associated; heparan sulfate proteoglycan core protein; syndecan proteoglycan 2; Syndecan 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us