Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SELENOS (Selenoprotein S) Full Length (CAT#: MPC1845K) Made to Order

This product is a 21.1 kDa Human SELENOS membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SELENOS
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 21.1 kDa
  • TMD
  • 1
  • Sequence
  • MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQK
    LSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKH
    KEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLK
    RKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SELENOS
  • Full Name
  • Selenoprotein S
  • Introduction
  • This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Two additional phylogenetically conserved stem-loop structures (Stem-loop 1 and Stem-loop 2) in the 3' UTR of this mRNA have been shown to function as modulators of Sec insertion. An alternatively spliced transcript variant, lacking the SECIS element and encoding a non-Sec containing shorter isoform, has been described for this gene (PMID:23614019).
  • Alternative Names
  • SELENOS; SELS; VIMP; ADO15; SBBI8; SEPS1; AD-015; VCP interacting membrane selenoprotein; VCP-interacting membrane protein; tanis; valosin-containing protein-interacting membrane protein; Selenoprotein S

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us