Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SEMA3B (Semaphorin 3B) for Antibody Discovery (CAT#: MP1118X)

This product is a 40.6 kDa Human SEMA3B membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SEMA3B
  • Protein Length
  • Full-length
  • Molecular Weight
  • 40.6 kDa
  • Sequence
  • MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SEMA3B
  • Full Name
  • Semaphorin 3B
  • Introduction
  • The protein encoded by this gene belongs to the class-3 semaphorin/collapsin family, whose members function in growth cone guidance during neuronal development. This family member inhibits axonal extension and has been shown to act as a tumor suppressor by inducing apoptosis. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • SemA; SEMA5; SEMAA; semaV; LUCA-1; semaphorin-3B; sema A(V); sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B; semaphorin A; semaphorin-V

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us