Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SERTM2 (Serine rich and transmembrane domain containing 2) Full Length (CAT#: MPC2148K) Made to Order

This product is a 10.2 kDa Human SERTM2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SERTM2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 10.2 kDa
  • TMD
  • 1
  • Sequence
  • MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYMYVGLFLSLLAILL
    ILLFTMLLRLKHVISPINSDSTESVPQFTDVEMQSRIPTP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SERTM2
  • Full Name
  • Serine rich and transmembrane domain containing 2
  • Alternative Names
  • SERTM2; LINC00890; DKFZp686D0853; serine-rich and transmembrane domain-containing 2; long intergenic non-protein coding RNA 890; Serine rich and transmembrane domain containing 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us