Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SGCD (Sarcoglycan delta) Full Length (CAT#: MPC4177K) Made to Order

This product is a made-to-order Human SGCD membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SGCD
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLA
    MTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIQSRPGNA
    LYFKSARNVTVNILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFS
    ADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLV
    MEAPKGVEINAEAGNMEATCRTELRLESKDGEIKLDAAKIRLPRLPHGSY
    TPTGTRQKVFEICVCANGRLFLSQAGAGSTCQINTSVCL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • SGCD
  • Full Name
  • Sarcoglycan delta
  • Introduction
  • The protein encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
  • Alternative Names
  • SGCD; SGD; DAGD; 35DAG; CMD1L; SGCDP; LGMDR6; SG-delta; delta-sarcoglycan; 35 kDa dystrophin-associated glycoprotein; delta-SG; dystrophin associated glycoprotein, delta sarcoglycan; placental delta sarcoglycan; sarcoglycan, delta (35kDa dystrophin-associated glycoprotein); Sarcoglycan delta

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us