Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SGCE (Sarcoglycan epsilon) Expressed in CHO for Antibody Discovery, Partial (47-317aa) (CAT#: MPX0124K)

This product is a 58 kDa Human SGCE membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SGCE
  • Protein Length
  • Partial (47-317aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 58 kDa
  • TMD
  • 1
  • Sequence
  • DRNV
    YPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPITFNTNLMGYPDRPGW
    LRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARHNLIINI
    MSAEDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAIN
    ITSALDRGGRVPLPINDLKEGVYVMVGADVPFSSCLREVENPQNQLRCSQ
    EMEPVITCDKKFRTQFYIDWCKISLVDKTKQVSTYQEVIRGEGILPDGGE
    YKPPSDSLKSRDYYTDF

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • SGCE
  • Full Name
  • Sarcoglycan epsilon
  • Introduction
  • This gene encodes the epsilon member of the sarcoglycan family. Sarcoglycans are transmembrane proteins that are components of the dystrophin-glycoprotein complex, which link the actin cytoskeleton to the extracellular matrix. Unlike other family members which are predominantly expressed in striated muscle, the epsilon sarcoglycan is more broadly expressed. Mutations in this gene are associated with myoclonus-dystonia syndrome. This gene is imprinted, with preferential expression from the paternal allele. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A pseudogene associated with this gene is located on chromosome 2.
  • Alternative Names
  • SGCE; ESG; DYT11; epsilon-SG; epsilon-sarcoglycan; dystonia 11, myoclonic; Sarcoglycan epsilon

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us