Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SIGLEC5 (Sialic acid binding Ig like lectin 5) Expressed in NS0 for Antibody Discovery, Partial (17-434aa) (CAT#: MPX0807K)

This product is a 73 kDa Human SIGLEC5 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SIGLEC5
  • Protein Length
  • Partial (17-434aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 73 kDa
  • TMD
  • 1
  • Sequence
  • EKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSW
    YSSPPLYVYWFRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKN
    CSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVTALIEKPDIHF
    LEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTL
    TPRPEDHGTNLTCQMKRQGAQVTTERTVQLNVSYAPQTITIFRNGIALEI
    LQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILE
    LRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCS

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • SIGLEC5
  • Full Name
  • Sialic acid binding Ig like lectin 5
  • Introduction
  • This gene encodes a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family. These cell surface lectins are characterized by structural motifs in the immunoglobulin (Ig)-like domains and sialic acid recognition sites in the first Ig V set domain. The encoded protein is a member of the CD33-related subset of Siglecs and inhibits the activation of several cell types including monocytes, macrophages and neutrophils. Binding of group B Streptococcus (GBS) to the encoded protein plays a role in GBS immune evasion.
  • Alternative Names
  • SIGLEC5; CD170; OBBP2; CD33L2; OB-BP2; SIGLEC-5; CD33 antigen-like 2; OB-binding protein 2; obesity-binding protein 2; sialic acid-binding immunoglobulin-like lectin 5; Sialic acid binding Ig like lectin 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us