Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SIGMAR1 (Sigma non-opioid intracellular receptor 1) Full Length (CAT#: MPC1116K) Made to Order

This product is a 25.1 kDa Human SIGMAR1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SIGMAR1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25.1 kDa
  • TMD
  • 1
  • Sequence
  • MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYA
    GLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASL
    SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE
    TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLF
    YTLRSYARGLRLELTTYLFGQDP

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag tag at N-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SIGMAR1
  • Full Name
  • Sigma non-opioid intracellular receptor 1
  • Introduction
  • This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
  • Alternative Names
  • SIGMAR1; SRBP; ALS16; DSMA2; OPRS1; SR-BP; SIG-1R; SR-BP1; sigma1R; hSigmaR1; SR31747 binding protein 1; aging-associated gene 8 protein; sigma 1-type opioid receptor; AAG8; Sigma non-opioid intracellular receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us