Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLAMF7 (SLAM family member 7) expressed in insect for Antibody Discovery (CAT#: MP0158Q)

This product is a 23.4 kDa Human SLAMF7 membrane protein expressed in Insect. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLAMF7
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 23.4 kDa
  • TMD
  • 1
  • Sequence
  • MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL

Product Description

  • Expression Systems
  • Insect
  • Tag
  • His
  • Endotoxin
  • < 1.0 EU per 1 microgram of protein
  • Purity
  • >95% by SDS - PAGE
  • Buffer
  • 10% glycerol

Target

  • Target Protein
  • SLAMF7
  • Full Name
  • SLAM family member 7
  • Introduction
  • Isoform 3 does not mediate any NK cell activation.
  • Alternative Names
  • 19A; CD319; CRACC; CS1;SLAM family member 7; 19A24 protein; CD2 subset 1; CD2-like receptor activating cytotoxic cells; membrane protein FOAP-12; novel LY9 (lymphocyte antigen 9) like protein; protein 19A; CD2-like receptor-activating cytotoxic cells; Novel Ly9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us