Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLAMF9 (SLAM family member 9) Expressed in CHO for Antibody Discovery, Partial (19-210aa) (CAT#: MPX0456K)

This product is a 48 kDa Human SLAMF9 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLAMF9
  • Protein Length
  • Partial (19-210aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 48 kDa
  • TMD
  • 1
  • Sequence
  • RRLWRWCGSEEVVAVLQESISLPLEIPPDEEV
    ENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDPSYSLHISNL
    SWEDSGLYQAQVNLRTSQISTMQQYNICVYRWLSEPQITVNFESSGEGAC
    SMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTC
    RANNPISNVS

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • SLAMF9
  • Full Name
  • SLAM family member 9
  • Introduction
  • This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • SLAMF9; CD2F10; CD84H1; SF2001; CD2F-10; CD84-H1; CD2 family member 10; CD84 homolog 1; cluster of differentiation 2 antigen family member 10; cluster of differentiation 84 homolog 1; signaling lymphocytic activation molecule family member 2001; signaling lymphocytic activation molecule family member 9; SLAM family member 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us