Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC1A3 (Solute carrier family 1 member 3) Expressed in E.coli with 6xHis and KSI tag at the N-terminus for Antibody Discovery, Partial (146-236aa) (CAT#: MPX4163K)

This product is a 25.5 kDa Human SLC1A3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC1A3
  • Protein Length
  • Partial (146-236aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25.5 kDa
  • TMD
  • 8
  • Sequence
  • HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and KSI tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC1A3
  • Full Name
  • Solute carrier family 1 member 3
  • Introduction
  • This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • EA6; EAAT1; GLAST; GLAST1; excitatory amino acid transporter 1; GLAST-1; sodium-dependent glutamate/aspartate transporter 1; solute carrier family 1 (glial high affinity glutamate transporter), member 3; SLC1A3; Solute carrier family 1 member 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us