Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC25A31 (Solute carrier family 25 member 31) Full Length (CAT#: MPC1992K) Made to Order

This product is a 35 kDa Human SLC25A31 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A31
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 35 kDa
  • TMD
  • 6
  • Sequence
  • MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQV
    QASSKQISPEARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALN
    FAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFAR
    TRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYR
    ASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRM
    MMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL
    YDKIKEFFHIDIGGR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC25A31
  • Full Name
  • Solute carrier family 25 member 31
  • Introduction
  • The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is also thought to play a role in spermatogenesis, where it is believed to associate with a part of the flagellar cytoskeleton and with glycolytic enzymes. Male mice with mutations in the mouse ortholog of this gene are sterile and spermatocytes display an early meiotic arrest phenotype. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • SLC25A31; AAC4; ANT4; ANT 4; SFEC35kDa; ADP/ATP translocase 4; ADP,ATP carrier protein 4; adenine nucleotide translocase 4; adenine nucleotide translocator 4; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31; sperm flagellar energy carrier protein; Solute carrier family 25 member 31

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us