Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC25A6 (Solute carrier family 25 member 6) Full Length (CAT#: MPC1315K) Made to Order

This product is a 32.8 kDa Human SLC25A6 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A6
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 32.8 kDa
  • TMD
  • 6
  • Sequence
  • MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQ
    YKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFL
    GGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGT
    EREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKG
    MLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIM
    YTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC25A6
  • Full Name
  • Solute carrier family 25 member 6
  • Introduction
  • This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein is implicated in the function of the permability transition pore complex (PTPC), which regulates the release of mitochondrial products that induce apoptosis. The human genome contains several non-transcribed pseudogenes of this gene.
  • Alternative Names
  • SLC25A6; ANT; AAC3; ANT3; ANT 2; ANT 3; ANT3Y; ADP/ATP translocase 3; ADP,ATP carrier protein 3; ADP,ATP carrier protein, liver; ADP/ATP translocator of liver; adenine nucleotide translocator 3; epididymis secretory sperm binding protein; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6; Solute carrier family 25 member 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us