Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC25A5 (Solute carrier family 25 member 5) Full Length (CAT#: MPC1075K) Made to Order

This product is a 32.8 kDa Human SLC25A5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A5
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 32.8 kDa
  • TMD
  • 6
  • Sequence
  • MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQ
    YKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFL
    GGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGA
    EREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKG
    MLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIM
    YTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC25A5
  • Full Name
  • Solute carrier family 25 member 5
  • Introduction
  • This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.
  • Alternative Names
  • SLC25A5; T2; T3; 2F1; AAC2; ANT2; ADP/ATP translocase 2; adenine nucleotide translocator 2 (fibroblast); solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5; Adenine nucleotide translocator 2; ADP,ATP carrier protein 2; ADP,ATP carrier protein, fibroblast isoform; Solute carrier family 25 member 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us