Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLITRK2 (SLIT and NTRK like family member 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1082K)

This product is a Human SLITRK2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLITRK2
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFIFIFHSWILLFHFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLITRK2
  • Full Name
  • SLIT and NTRK like family member 2
  • Introduction
  • This gene encodes an integral membrane protein that contains two N-terminal leucine-rich repeats domains and contains C-terminal regions similar to neurotrophin receptors. The encoded protein may play a role in modulating neurite activity. Alternatively spliced transcript variants encoding the same protein have been described.
  • Alternative Names
  • SLITRK2; CXorf1; CXorf2; SLITL1; TMEM257; slit and trk like gene 2; slit-like 1; transmembrane protein 257; SLIT and NTRK like family member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us