Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SMDT1 (Single-pass membrane protein with aspartate rich tail 1) Full Length (CAT#: MPC1143K) Made to Order

This product is a 11.4 kDa Human SMDT1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SMDT1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 11.4 kDa
  • TMD
  • 1
  • Sequence
  • MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIV
    TRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVP
    EDDDDDD

Product Description

  • Expression Systems
  • HEK293
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SMDT1
  • Full Name
  • Single-pass membrane protein with aspartate rich tail 1
  • Introduction
  • This gene encodes a core regulatory component of a calcium channel in the mitochondrial inner membrane.
  • Alternative Names
  • SMDT1; DDDD; EMRE; C22orf32; essential MCU regulator, mitochondrial; UPF0466 protein C22orf32, mitochondrial; single-pass membrane protein with aspartate-rich tail 1, mitochondrial; Single-pass membrane protein with aspartate rich tail 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us