Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SMIM30 (Small integral membrane protein 30) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1300K)

This product is a Human SMIM30 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SMIM30
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MDSETPKQKARDAKFMLVKRLWQDKDGHLCRIVLHDHGWNPSETPVGPQMHGARSLSMEESAAAGIVGNVVWRLRPPRHSCNGCFLEGRVTWNLLISASGAPGRENFKSDRILYIPFLGTFSPQDSNIMTSVSTQLSLVLMSLLLVLPVVEAVEAGDAIALLLGVVLSITGICACLGVYARKRNGQM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SMIM30
  • Full Name
  • Small integral membrane protein 30
  • Alternative Names
  • SMIM30; LINC00998; long intergenic non-protein coding RNA 998; putative transmembrane protein LINC00998; Small integral membrane protein 30

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us