Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SPATA19 (Spermatogenesis associated 19) for Antibody Discovery (CAT#: MP1286X)

This product is a 45.6 kDa Human SPATA19 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SPATA19
  • Protein Length
  • Full-length
  • Molecular Weight
  • 45.6 kDa
  • Sequence
  • MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Protein Format
  • Liposome
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SPATA19
  • Full Name
  • Spermatogenesis associated 19
  • Introduction
  • The SPATA19 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, and rat.
  • Alternative Names
  • CT132; SPAS1; spergen1; spermatogenesis-associated protein 19, mitochondrial; cancer/testis antigen 132; spergen-1; spermatogenic cell-specific gene 1 protein; spermatogenic specific-gene1; testis secretory sperm-binding protein Li 243mP

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us