Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SPTSSB (Serine palmitoyltransferase small subunit B) Full Length (CAT#: MPC4741K) Made to Order

This product is a made-to-order Human SPTSSB membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SPTSSB
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAY
    VFIPIHIRLAWEFFSKICGYHSTISN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • SPTSSB
  • Full Name
  • Serine palmitoyltransferase small subunit B
  • Introduction
  • Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120).
  • Alternative Names
  • SPTSSB; ADMP; SSSPTB; C3orf57; serine palmitoyltransferase small subunit B; androgen down regulated in mouse prostate; likely ortholog of androgen down regulated gene expressed in mouse prostate; small subunit of serine palmitoyltransferase B; Serine palmitoyltransferase small subunit B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us